AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-TPPP3 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-TPPP3 rabbit polyclonal antibody로, 인간 TPPP3 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 면역형광 및 면역조직화학에 적합하며, 친화 정제된 glycerol 완충 용액 형태로 제공됩니다. -20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-TPPP3 antibody produced in rabbit
Anti-TPPP3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms: Anti-p20, Anti-tubulin polymerization-promoting protein family member 3, Anti-CGI-38, Anti-p25gamma
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 상태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 단위 | Antibody small pack of 25 μL |
| 기술(Technique) | Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | ATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRL |
| UniProt 수납 번호 | Q9BW30 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Gene: TPPP3 (51673)
Tubulin polymerization promoting protein family member 3 (TPPP3) gene is located on human chromosome 16.
It has microtubule-associated protein (MAP) function and contains a C-terminal p25 (protein 25) α domain.
TPPP3 is expressed as a disordered protein.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.