AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-METTL21B antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-METTL21B 항체로, 인간 METTL21B 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로 면역조직화학(IHC)에 적합하며, −20°C에서 보관합니다. 버퍼링된 글리세롤 수용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-METTL21B antibody produced in rabbit
Anti-METTL21B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Also known as:
Anti-FAM119B, Anti-methyltransferase like 21B, Anti-DKFZP586D0919
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 종류 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | 25 μL (small pack) |
| 적용 기술 | Immunohistochemistry (IHC): 1:200–1:500 |
| 면역원 서열 | TFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
유전자 정보
Gene: METTL21B (Human, Gene ID: 25895)
설명:
Methyltransferase like 21B (METTL21B), also known as EEF1A lysine methyltransferase 3 (EEF1AKMT3), belongs to the methyltransferase family 16 (MTF16). It is encoded by the gene mapped to human chromosome 12q13.3–q14.1. Putative METTL21B ortholog expression is restricted to vertebrates and is localized mainly in cytoplasm and centrioles.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.