AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-BAAT antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-BAAT polyclonal 항체로, 인간 BAAT 단백질을 인식합니다. Prestige Antibodies® Powered by Atlas Antibodies 제품군에 속하며, immunohistochemistry(1:500–1:1000)에 적합합니다. buffered aqueous glycerol 용액 형태로 제공되며 −20°C에 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA021330-100UL Anti-BAAT antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-BAAT antibody produced in rabbit
Anti-BAAT antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
Anti-BAAT (bile acid CoA: amino acid N-acyltransferase, glycine N-choloyltransferase).
생물학적 소스
rabbit
제품 스펙
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| 결합 | unconjugated |
| 항체 형태 | affinity isolated antibody |
| 항체 유형 | primary antibodies |
| 클론 | polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | buffered aqueous glycerol solution |
| species reactivity | human |
| 포장 | 25 μL (small pack) |
| 적용 기술 | immunohistochemistry: 1:500–1:1000 |
| 면역원 서열 | MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDLNHASSLGGDYMGVH |
| UniProt 수납 번호 | Q14032 |
| 배송 상태 | wet ice |
| 저장 온도 | −20°C |
Gene Information
human BAAT(570)
The gene BAAT (bile acid-CoA: amino acid N-acyltransferase) is mapped to human chromosome 9q22.3.
It belongs to the type 1 acyl-CoA thioesterase gene family.
It is strongly expressed in liver, gallbladder, and proximal and distal intestine.
The protein localizes in the cytoplasm and peroxisomes.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.