
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-BAAT antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-BAAT polyclonal 항체로, 인간 BAAT 단백질을 인식합니다. Prestige Antibodies® Powered by Atlas Antibodies 제품군에 속하며, immunohistochemistry(1:500–1:1000)에 적합합니다. buffered aqueous glycerol 용액 형태로 제공되며 −20°C에 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA021330-100UL Anti-BAAT antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-BAAT antibody produced in rabbit
Anti-BAAT antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
Anti-BAAT (bile acid CoA: amino acid N-acyltransferase, glycine N-choloyltransferase).
생물학적 소스
rabbit
제품 스펙
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| 결합 | unconjugated |
| 항체 형태 | affinity isolated antibody |
| 항체 유형 | primary antibodies |
| 클론 | polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | buffered aqueous glycerol solution |
| species reactivity | human |
| 포장 | 25 μL (small pack) |
| 적용 기술 | immunohistochemistry: 1:500–1:1000 |
| 면역원 서열 | MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDLNHASSLGGDYMGVH |
| UniProt 수납 번호 | Q14032 |
| 배송 상태 | wet ice |
| 저장 온도 | −20°C |
Gene Information
human BAAT(570)
The gene BAAT (bile acid-CoA: amino acid N-acyltransferase) is mapped to human chromosome 9q22.3.
It belongs to the type 1 acyl-CoA thioesterase gene family.
It is strongly expressed in liver, gallbladder, and proximal and distal intestine.
The protein localizes in the cytoplasm and peroxisomes.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



