CacheBy
Merck Anti-NEK3 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-NEK3 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-NEK3 항체로, 인간 NEK3 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® Powered by Atlas Antibodies 라인 제품으로, 면역조직화학(IHC)에 적합하며 −20°C에서 보관합니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
Merck HPA019062-100UL Anti-NEK3 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-NEK3 antibody produced in rabbit

Anti-NEK3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution

Also known as: Anti-HSPK36, Anti-MGC29949, Anti-NIMA (never in mitosis gene a)-related kinase 3


제품 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibody
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species Reactivity Human
포장 25 μL (small pack)
실험 기술 Immunohistochemistry (1:50–1:200)
면역원 서열 NLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEASTV
UniProt 번호 P51956
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Gene: NEK3 (never in mitosis A-related kinase 3)
Gene ID: NEK3 (4752)
Chromosomal Location: Human chromosome 13q14.13

The NEK3 gene belongs to the NIMA (never in mitosis A) family of proteins and is strongly expressed in testis, ovary, and brain.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.