AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-LINGO3 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-LINGO3 폴리클로날 항체로, 인간 LINGO3 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, 면역조직화학(IHC)에 적합합니다. 친화력 정제된 항체로 −20°C에서 보관하며, 25 μL 소포장으로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-LINGO3 antibody produced in rabbit
Anti-LINGO3 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈의 친화력 정제 항체입니다.
Buffered aqueous glycerol solution 형태로 제공되며, 인간 LINGO3 단백질을 인식합니다.
관련 명칭
- Anti-LERN2
- Anti-LRRN6B
- Anti-leucine rich repeat and Ig domain containing 3
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 종류
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
25 μL (antibody small pack)
적용 기술
- Immunohistochemistry (IHC): 1:200–1:500
면역원 서열
LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
- Human: LINGO3 (645191)
- Leucine rich repeat and Ig domain containing 3 recombinant protein epitope signature tag (PrEST)
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Type | Primary |
| Clone | Polyclonal |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Pack Size | 25 μL |
| Application | Immunohistochemistry (1:200–1:500) |
| Storage Temperature | −20°C |
| Shipping Condition | Wet ice |
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.