AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-GPRIN2 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-GPRIN2 항체로, 인간 GPRIN2 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로 면역형광 및 면역조직화학에 적합합니다. −20°C에서 보관하며, buffered aqueous glycerol 용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-GPRIN2 antibody produced in rabbit
Anti-GPRIN2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms:
Anti-MGC15171, Anti-G protein regulated inducer of neurite outgrowth 2, Anti-KIAA0514
제품 개요
이 항체는 토끼에서 생산된 polyclonal 항체로, 인간 GPRIN2 단백질을 인식합니다.
면역형광(immunofluorescence) 및 면역조직화학(immunohistochemistry) 실험에 적합합니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody Type | Primary antibody |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | 25 μL small pack |
| Techniques | Immunofluorescence (0.25–2 μg/mL), Immunohistochemistry (1:20–1:50) |
| Immunogen Sequence | QAEPKAAEQLATTTCHALPPAALLCGMREMREVGAGGCCHALPATGILAFPKLVASVSESGLQAQHGVKIHCRL |
| UniProt Accession No. | O60269 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20 °C |
| Gene Information | Human GPRIN2 (9721) |
추가 정보
G protein regulated inducer of neurite outgrowth 2 recombinant protein epitope signature tag (PrEST)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.