CacheBy
Merck Anti-DZANK1 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-DZANK1 antibody produced in rabbit

상품 한눈에 보기

Rabbit에서 생산된 Anti-DZANK1 polyclonal antibody로, Atlas Antibodies의 Prestige Antibodies® 라인 제품입니다. Human DZANK1 단백질에 반응하며, 면역조직화학(IHC)에 적합합니다. Affinity isolated 형식으로 −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-DZANK1 antibody produced in rabbit

Anti-DZANK1 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

대체 명칭:
Anti-bA189K21.8, Anti-C20orf84, Anti-ANKRD64, Anti-dJ568F9.2, Anti-FLJ30892, Anti-C20orf12


생물학적 정보

항목 내용
Biological source Rabbit
Quality Level 100
Conjugate Unconjugated
Antibody form Affinity isolated antibody
Product type Primary antibodies
Clone Polyclonal
Product line Prestige Antibodies® Powered by Atlas Antibodies
Form Buffered aqueous glycerol solution
Species reactivity Human
Packaging Small pack of 25 μL
Technique(s) Immunohistochemistry (IHC): 1:20–1:50
Immunogen sequence EKMSDHKPLLTAISPGRGYWRRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLYLNKAVNFSDHLLSSAA
UniProt accession no. Q9NVP4
Shipping condition Wet ice
Storage temperature −20°C

Gene Information

Human gene: DZANK1 (55184)
Double zinc ribbon and ankyrin repeat domains 1


제품 이미지

(이미지 없음)

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.