
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-NETO1 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-NETO1 rabbit 항체로, 인간 NETO1 단백질을 인식하는 polyclonal primary antibody입니다. Prestige Antibodies® 라인 제품으로, 면역형광(immunofluorescence)에 적합하며 −20°C에서 보관합니다. Affinity isolated 형태로 높은 특이성과 재현성을 제공합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-NETO1 antibody produced in rabbit
Anti-NETO1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈의 affinity isolated rabbit polyclonal antibody입니다. 인간 NETO1 단백질을 표적하며 면역형광(immunofluorescence) 분석에 적합합니다.
주요 특징
- Biological Source: Rabbit
- Product Type: Primary Antibody
- Form: Buffered aqueous glycerol solution
- Species Reactivity: Human
- Conjugation: Unconjugated
- Clone Type: Polyclonal
- Product Line: Prestige Antibodies® Powered by Atlas Antibodies
- Quality Level: 100
스펙 정보
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Type | Primary Antibody |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Small pack, 25 μL |
| Technique(s) | Immunofluorescence: 0.25–2 μg/mL |
| Immunogen Sequence | PIIGRFCGQQNPPVIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKD |
| UniProt Accession | Q8TDF5 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20 °C |
| Gene Information | Human NETO1 (81832), neuropilin (NRP) and tolloid (TLL)-like 1 |
관련 정보
- Prestige Antibodies® Powered by Atlas Antibodies
- NETO1: Neuropilin (NRP) and tolloid (TLL)-like 1
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



