CacheBy
Merck Anti-DESI2 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-DESI2 antibody produced in rabbit

상품 한눈에 보기

Merck의 토끼 유래 Anti-DESI2 항체는 Prestige Antibodies® 시리즈로, 인간 DESI2 단백질을 인식하는 polyclonal 항체입니다. 면역형광 등 다양한 연구에 활용 가능하며, −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-DESI2 antibody produced in rabbit

Anti-DESI2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody recognizing DESI2 (FLJ21998, FAM152A, C1orf121, PPPDE1, PNAS-4, CGI-146).


제품 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 형태 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species Reactivity Human
포장 Antibody small pack of 25 μL
적용 기술(technique) Immunofluorescence: 0.25–2 μg/mL
면역원 서열 VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY
UniProt 수납 번호 Q9BSY9
배송 상태 Wet ice
저장 온도 −20 °C

Gene Information

DESI2 (desumoylating isopeptidase 2) is a member of the putative deubiquitinating isopeptidase PPPDE (putative peptidase domain) superfamily.
The PNAS-4 protein contains two or three hydrophobic motifs and a conserved N-terminal DUF (domain of unknown function) 862 domain.
Located on human chromosome 1q44.

DESI2 (51029)

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.