
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-DESI2 antibody produced in rabbit
상품 한눈에 보기
Merck의 토끼 유래 Anti-DESI2 항체는 Prestige Antibodies® 시리즈로, 인간 DESI2 단백질을 인식하는 polyclonal 항체입니다. 면역형광 등 다양한 연구에 활용 가능하며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-DESI2 antibody produced in rabbit
Anti-DESI2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody recognizing DESI2 (FLJ21998, FAM152A, C1orf121, PPPDE1, PNAS-4, CGI-146).
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 적용 기술(technique) | Immunofluorescence: 0.25–2 μg/mL |
| 면역원 서열 | VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY |
| UniProt 수납 번호 | Q9BSY9 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
Gene Information
DESI2 (desumoylating isopeptidase 2) is a member of the putative deubiquitinating isopeptidase PPPDE (putative peptidase domain) superfamily.
The PNAS-4 protein contains two or three hydrophobic motifs and a conserved N-terminal DUF (domain of unknown function) 862 domain.
Located on human chromosome 1q44.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



