AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-C18orf25 antibody produced in rabbit
상품 한눈에 보기
Rabbit polyclonal antibody targeting human C18orf25 protein. Affinity-isolated and suitable for immunofluorescence applications. Supplied in buffered aqueous glycerol solution, shipped on wet ice and stored at −20°C.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-C18orf25 antibody produced in rabbit
Anti-C18orf25 Antibody Produced in Rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody recognizing RNF111L1, ARKL1, MGC12909.
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | 25 μL (small pack) |
| 적용 기술 | Immunofluorescence: 0.25–2 μg/mL |
| UniProt 번호 | Q96B23 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
유전자 정보
Human gene: C18orf25 (147339)
Recombinant protein corresponding to chromosome 18 open reading frame 25.
Sequence:
QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.