Merck Anti-IFIT1 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-IFIT1 항체로, 인간 IFIT1 단백질을 인식하는 고품질 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로, 면역형광 및 면역조직화학에 적합합니다. −20°C에서 보관하며, 25 μL 포장으로 제공됩니다.

브랜드: Merck Sigma
카테고리: Polyclonal Antibodies

#Merck #Sigma #Merck Sigma

Merck Sigma · Merck Anti-IFIT1 antibody produced in rabbit

Anti-IFIT1 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
또한 Anti-GARG-16, Anti-G10P1, Anti-IFI56, Anti-IFNAI1로도 알려져 있습니다.

생물학적 정보

Biological Source: Rabbit
Clone: Polyclonal
Species Reactivity: Human
Immunogen Sequence: KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH
Gene Information: Human IFIT1 (3434)
Interferon-induced protein with tetratricopeptide repeats 1

제품 특성

항목	내용
Quality Level	100
Conjugation	Unconjugated
Antibody Form	Affinity isolated antibody
Product Type	Primary antibodies
Product Line	Prestige Antibodies® Powered by Atlas Antibodies
Formulation	Buffered aqueous glycerol solution
Packaging	Antibody small pack of 25 μL
Storage Temperature	−20°C
Shipping Condition	Wet ice