AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-ARHGDIA antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-ARHGDIA 항체로, Rho GDP-dissociation inhibitor 1을 인식합니다. 인간 시료에 반응하며 Western blot과 IHC에 적합합니다. Affinity purified 폴리클로날 항체로, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-ARHGDIA antibody produced in rabbit
Anti-ARHGDIA antibody produced in rabbit
Affinity isolated antibody, buffered aqueous glycerol solution
- Anti-Rho-GDI alpha
- Anti-Rho GDP-dissociation inhibitor 1
- Anti-Rho GDI 1
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 적용 기술 | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:20–1:50 |
| 면역원 서열 | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSAD |
| UniProt 수납 번호 | P52565 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human ARHGDIA (396)
The gene ARHGDIA (Rho GDP-dissociation inhibitor 1) is mapped to human chromosome 17q25.3.
It belongs to the RhoGDI (Rho GDP-dissociation inhibitor) family of proteins and is widely expressed in human tissues.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.