AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-GJD2 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-GJD2 항체로, 인간 GJD2(Cx36) 단백질을 인식하는 폴리클로날 항체. Prestige Antibodies® 제품군에 속하며 면역조직화학(IHC)에 적합. 친화 정제된 비결합 항체로 −20°C에서 보관.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-GJD2 antibody produced in rabbit
Anti-GJD2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
Synonyms
- Anti-Gap junction alpha-9 protein
- Anti-Gap junction delta-2 protein
- Anti-Cx36
- Anti-Connexin-36
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | Antibody small pack of 25 μL |
| 적용 기술 | Immunohistochemistry (1:20–1:50) |
| 면역원 서열 | GWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAYV |
| UniProt 번호 | Q9UKL4 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Gene: GJD2 (gap junction protein δ 2)
Synonym: CX36 (connexin 36)
Entrez ID: GJD2(57369)
Chromosome: Human chromosome 15q14
The gene GJD2 encodes one of three major neuronal connexins, expressed in neurons and β-cells of the pancreas. CX36 is the only connexin expressed in β-cells of the pancreas in adults.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.