
Merck Anti-ATP7B antibody produced in rabbit
Merck의 Anti-ATP7B rabbit polyclonal antibody로, 인간 ATP7B 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품이며, 면역조직화학(IHC)에 적합합니다. 친화력 분리 항체로 −20°C에서 보관하며, 25 μL 소포장으로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATP7B antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.
Anti-Copper pump 2, Anti-Copper-transporting ATPase 2, Anti-Wilson disease-associated protein.
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
적용 기술
- Immunohistochemistry (IHC): 1:20–1:50
면역원 서열
RKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ATP7B(540)
ATP7B (ATPase, Cu++ transporting, β polypeptide) gene is mapped to human chromosome 13. It is expressed predominantly in liver, kidney, and placenta in humans. The 1465 amino acid long protein contains eight transmembrane segments, six copper-binding motifs at its N-terminus, a CPC motif in an intramembranous region, and a SEHPL motif.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody type | Primary, polyclonal |
| Product line | Prestige Antibodies® |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Application | Immunohistochemistry (1:20–1:50) |
| Packaging | 25 μL |
| Storage temperature | −20°C |
| Shipment condition | Wet ice |
| UniProt accession | P35670 |
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|




