Merck Anti-CFLAR antibody produced in rabbit

Anti-CFLAR antibody produced in rabbit

제품 개요

• 형태: Affinity isolated antibody, buffered aqueous glycerol solution
• 대상: CASP8 and FADD-like apoptosis regulator (CFLAR)
• 다른 명칭: Anti-CASP8AP1, Anti-CLARP, Anti-CASH, Anti-Casper, Anti-MRIT, Anti-I-FLICE, Anti-C-FLIP, Anti-FLAME, Anti-FLIP

생물학적 소스

rabbit

품질 등급

100 (M-Clarity Program)

결합 형태

unconjugated

항체 형태

affinity isolated antibody

항체 종류

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

제형

buffered aqueous glycerol solution

반응 종

human

포장

antibody small pack of 25 μL

적용 기술

• Immunofluorescence: 0.25–2 μg/mL
• Immunohistochemistry: 1:200–1:500

면역원 서열

IHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSS

UniProt 수납 번호

O15519

배송 상태

wet ice

저장 온도

−20°C

유전자 정보

human ... CFLAR(8837)
CFLAR (CASP8 and FADD-like apoptosis regulator) 유전자는 인간 염색체 2q33-q34에 위치하며, 단백질은 세포질에 존재합니다. CFLAR은 일반적으로 c-FLIP (Cellular FLICE-like inhibitory protein)으로 알려져 있습니다.

제품 스펙 요약

항목	내용
Biological source	Rabbit
Quality Level	100
Conjugation	Unconjugated
Antibody form	Affinity isolated antibody
Antibody type	Primary antibodies
Clone	Polyclonal
Product line	Prestige Antibodies®
Form	Buffered aqueous glycerol solution
Species reactivity	Human
Package size	25 μL
Techniques	IF (0.25–2 μg/mL), IHC (1:200–1:500)
Immunogen sequence	Provided
UniProt accession	O15519
Shipping condition	Wet ice
Storage temperature	−20°C