AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-SLC35A2 antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-SLC35A2 항체로, 인간 SLC35A2 단백질을 인식하는 고품질 polyclonal 항체입니다. Immunofluorescence 및 Immunohistochemistry에 적합하며, Prestige Antibodies® 라인으로 높은 특이성과 재현성을 제공합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-SLC35A2 antibody produced in rabbit
Anti-SLC35A2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms
Anti-UGALT, Anti-UGAT, Anti-solute carrier family 35 (UDP-galactose transporter), member A2, Anti-UGTL, Anti-UGT2, Anti-UGT, Anti-UGT1
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 종류 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| Technique(s) | Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:20–1:50 |
| 면역원 서열 | RGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS |
| UniProt 수납 번호 | P78381 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human SLC35A2 (7355)
Solute carrier family 35 member A2 (SLC35A2) gene is mapped to human chromosome Xp11.23. This gene codes for Uridine diphosphate (UDP)-galactose transporter (UGT). UGT belongs to the family of nucleotide sugar transporters (NSTs). UGT1 and UGT2 are the two alternative splicing variants of UGT.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.