
Merck Anti-NEU1 antibody produced in rabbit
Rabbit polyclonal Anti-NEU1 antibody for human sialidase-1 detection. Suitable for immunofluorescence and immunohistochemistry. Supplied as buffered aqueous glycerol solution. Stored at −20°C, shipped on wet ice.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NEU1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody in buffered aqueous glycerol solution.
Synonyms
Anti-Sialidase-1, Anti-N-acetyl-alpha-neuraminidase 1, Anti-G9 sialidase, Anti-Lysosomal sialidase, Anti-Acetylneuraminyl hydrolase
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| Technique(s) | Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | RDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNG |
| UniProt 수납 번호 | Q99519 |
| Application(s) | Research pathology |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human NEU1(4758) |
Gene Description
The human sialidase (neuraminidase 1) NEU1 gene is mapped on chromosome 6p21.3 and codes for a ~45 kDa protein NEU1, with potential three N-linked glycosylation sites. This gene consists of five introns and six exons. The encoded protein is localized to plasma membrane and lysosomal membrane.
제품 이미지
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|




