AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-NEU1 antibody produced in rabbit
상품 한눈에 보기
Rabbit polyclonal Anti-NEU1 antibody for human sialidase-1 detection. Suitable for immunofluorescence and immunohistochemistry. Supplied as buffered aqueous glycerol solution. Stored at −20°C, shipped on wet ice.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-NEU1 antibody produced in rabbit
Anti-NEU1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody in buffered aqueous glycerol solution.
Synonyms
Anti-Sialidase-1, Anti-N-acetyl-alpha-neuraminidase 1, Anti-G9 sialidase, Anti-Lysosomal sialidase, Anti-Acetylneuraminyl hydrolase
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| Technique(s) | Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | RDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNG |
| UniProt 수납 번호 | Q99519 |
| Application(s) | Research pathology |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human NEU1(4758) |
Gene Description
The human sialidase (neuraminidase 1) NEU1 gene is mapped on chromosome 6p21.3 and codes for a ~45 kDa protein NEU1, with potential three N-linked glycosylation sites. This gene consists of five introns and six exons. The encoded protein is localized to plasma membrane and lysosomal membrane.
제품 이미지
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.