Merck Anti-MANEA antibody produced in rabbit
Rabbit에서 생산된 Anti-MANEA 항체로 인간 단백질에 반응하는 1차 폴리클로날 항체입니다. Prestige Antibodies® Powered by Atlas Antibodies 제품군에 속하며, 면역조직화학(IHC)에 적합합니다. −20°C에서 보관하며, 향상된 검증(Enhanced Validation)을 통해 신뢰성 확보.
- 카탈로그번호
- HPA011069-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-MANEA antibody produced in rabbit
Anti-MANEA antibody produced in rabbit
Ab2, Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
Unconjugated
항체 형태
Affinity isolated antibody
항체 유형
Primary antibodies
클론
Polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
Buffered aqueous glycerol solution
반응 종
Human
포장
25 μL (antibody small pack)
향상된 검증
Independent
Learn more about Antibody Enhanced Validation (IHC application)
적용 기술
Immunohistochemistry (IHC): 1:20–1:50
면역원 서열
GVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYNLKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYKTKTGNALPMFYVYDSYITKPEKWANLLTTSGSRSIRNSPYDGLFIALLVEEKHKYDILQSGFDGIYT
UniProt 수납 번호
배송 상태
Wet ice
저장 온도
−20°C
Gene Information
Human ... MANEA (79694)
MANEA (mannosidase, endo-α) is a type II transmembrane glycosidic protein. This enzyme consists of 462 amino acids with a molecular weight of 53.6 kDa. The transmembrane region includes 19 amino acids near the N-terminal. This gene is located on human chromosome 6q16.1 and is expressed in multiple tissues such as brain, kidney, and liver.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary, Polyclonal |
| 반응 종 | Human |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 적용 기술 | Immunohistochemistry (1:20–1:50) |
| 포장 | 25 μL |
| 저장 온도 | −20°C |
| 배송 상태 | Wet ice |
| UniProt 번호 | Q5SRI9 |
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.