AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-S100A6 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-S100A6 rabbit antibody는 Prestige Antibodies® 라인 제품으로, 인체·쥐·흰쥐 시료에 반응하는 polyclonal 1차 항체입니다. 면역형광, 면역블롯, 면역조직화학에 적합하며, orthogonal RNAseq로 향상된 검증을 거친 고품질 항체입니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-S100A6 antibody produced in rabbit
Anti-S100A6 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
- 생물학적 소스: Rabbit
- 항체 형태: Affinity isolated antibody
- 항체 종류: Primary antibody (polyclonal)
- 제품 라인: Prestige Antibodies® Powered by Atlas Antibodies
- 결합 상태: Unconjugated
- 형태: Buffered aqueous glycerol solution
- 반응 종: Rat, Human, Mouse
- 포장: Small pack of 25 μL
스펙 정보
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| Enhanced Validation | Orthogonal RNAseq |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:1000–1:2500 |
| Immunogen Sequence | AIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNE |
| UniProt Accession | P06703 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human S100A6 (6277)
S100A6 (S100 calcium binding protein A6) gene encodes an EF-hand calcium binding protein that is a member of the S100 family of proteins. Also known as calcyclin, it contains a hydrophobic hinge region connecting EF-hands. Expressed in lineage-restricted astrocyte precursors and neural stem cells, it may be useful in analyzing astrocyte precursor characteristics.
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.