
Merck Anti-ICAM5 antibody produced in rabbit
토끼에서 생산된 Anti-ICAM5 항체로 인간 ICAM5 단백질을 인식하는 주요 항체입니다. Prestige Antibodies® 라인 제품으로 면역조직화학(IHC)에 적합하며, 정제된 글리세롤 완충 용액 형태로 제공됩니다. −20°C에서 보관하며 wet ice 상태로 배송됩니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-ICAM5 antibody produced in rabbit
Anti-ICAM5 antibody produced in rabbit
제품 개요
Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.
생물학적 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 상태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Orthogonal RNAseq |
| 기술(응용) | Immunohistochemistry: 1:20–1:50 |
| 면역원 서열 | VRSGELGAVIEGLLRVAREHAGTYRCEATNPRGSAAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDGKPQPSVKCVGSGGATEGVLLPLAPPDPSPRAPRIPRVLAPGIYVCNATNRHGSVAKTVVVS |
| UniProt 수납 번호 | Q9UMF0 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
유전자 정보
Gene: ICAM5 (7087)
ICAM5 (intercellular adhesion molecule 5), also known as telencephalin, is a member of the ICAM family with a molecular weight of approximately 130 kDa. It is expressed on mammalian telencephalon neurons and functions as a type I transmembrane glycoprotein. ICAM5 shares high homology with other ICAM members and contains 15 N-glycosylation sites within its nine Ig (immunoglobulin) domains. The gene is localized to human chromosome 19p13.2 and spans approximately 80 kb.
참고 정보
Learn more about Antibody Enhanced Validation
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



