Merck Anti-ULBP1 antibody produced in rabbit

상품 한눈에 보기

Merck의 Anti-ULBP1 rabbit antibody는 인간 ULBP1 단백질을 인식하는 polyclonal primary antibody입니다. Prestige Antibodies® 라인으로 높은 품질(100 level) 보장하며, immunohistochemistry(1:50–1:200)에 적합합니다. −20°C에서 보관하며 wet ice로 배송됩니다.

브랜드: Merck Sigma
카테고리: Polyclonal Antibodies

#Merck #Sigma #Merck Sigma

Merck Sigma · Merck Anti-ULBP1 antibody produced in rabbit

Anti-ULBP1 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.

생물학적 정보

Source: Rabbit
Species Reactivity: Human
Gene Information:
ULBP1 (Unique Long 16 binding protein 1) gene encodes a ligand for KLRK1/NKG2D (natural killer cell lectin-like receptor gene 2D) receptor.
It consists of α1 and α2 domains, which are connected to the cell surface through glycosylphosphatidylinositol.
This receptor is expressed on natural killer (NK) cells, NKT cells, γδ+ T cells and CD8+ T cells.
ULBP1(80329)

제품 사양

항목	내용
Quality Level	100
결합	Unconjugated
항체 형태	Affinity isolated antibody
항체 유형	Primary antibodies
클론	Polyclonal
제품 라인	Prestige Antibodies® Powered by Atlas Antibodies
형태	Buffered aqueous glycerol solution
포장	25 μL small pack
향상된 검증	Orthogonal RNAseq
Technique(s)	Immunohistochemistry: 1:50–1:200
면역원 서열	THCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMS
UniProt 수납 번호	Q9BZM6
배송 상태	Wet ice
저장 온도	−20°C