CacheBy
Merck Anti-TPO antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-TPO antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-TPO 폴리클로날 항체로 인간 TPO 단백질에 반응합니다. Prestige Antibodies® 라인 제품으로 면역조직화학(IHC)에 적합하며, 정제된 glycerol 완충 용액 형태입니다. −20°C에서 보관하며, Enhanced Validation을 통해 품질 검증이 강화되었습니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-TPO antibody produced in rabbit

Anti-TPO antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution 형태의 토끼 유래 Anti-TPO 항체입니다.

제품 스펙

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 형태 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
제형 Buffered aqueous glycerol solution
Species Reactivity Human
포장 Antibody small pack of 25 μL
향상된 검증 Orthogonal RNAseq (Antibody Enhanced Validation)
적용 기술 Immunohistochemistry: 1:200–1:500
면역원 서열 RELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWDFQPPLCKDVNECADGA
UniProt 수납 번호 P07202
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Human TPO (thyroid peroxidase) gene is localized to human chromosome 2 and contains 17 exons interspaced by 16 introns.
Gene ID: TPO (7173)

제품 이미지

(이미지 없음)

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.