
Merck Anti-APOA4 antibody produced in rabbit
토끼에서 생산된 Anti-APOA4 항체로, 인간 APOA4 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 정제된 affinity isolated 형태입니다. IHC 및 Western blot에 적합하며, Enhanced Validation으로 신뢰성이 높습니다. −20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-APOA4 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.
제품 사양
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 단위 | 25 μL (small pack) |
| 향상된 검증 (Enhanced Validation) | Orthogonal RNAseq, Recombinant expression |
| 적용 기술 (Technique) | Immunohistochemistry: 1:500–1:1000 Western blot: 0.04–0.4 μg/mL |
| 면역원 서열 (Immunogen Sequence) | LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP |
| UniProt 수납 번호 | P06727 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
유전자 정보
Gene: APOA4 (337)
The gene APOA4 is localized to the long arm of human chromosome 11 along with A1 (APOA1) and C3 (APOC3) genes. This gene contains three exons separated by two introns. Apo A-IV is synthesized in the mucosal cells of the small intestine as a preprotein. This 396-amino acid preprotein undergoes proteolytic processing, associates with chylomicrons during fat absorption, and is secreted into the lymph.
참고 링크
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-ARNT antibody produced in rabbit
840,700원

Merck Sigma
Merck Anti-TRAT1 antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-APOA4 antibody produced in rabbit
840,700원

Merck Sigma
Merck Anti-APOBEC3G antibody produced in rabbit

Merck Sigma
Merck Anti-APOOL antibody produced in rabbit
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|