AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-GATAD2A antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-GATAD2A 항체로, Prestige Antibodies® 라인 제품입니다. 인간, 생쥐, 랫트 시료에 반응하며, Western blot, IF, IHC에 적합합니다. 친화 정제된 비결합형 항체로 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-GATAD2A antibody produced in rabbit
Anti-GATAD2A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Rat, Human, Mouse |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Independent (Antibody Enhanced Validation) |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
적용 기술 (Recommended Applications)
- Immunoblotting (WB): 0.04–0.4 μg/mL
- Immunofluorescence (IF): 0.25–2 μg/mL
- Immunohistochemistry (IHC): 1:50–1:200
면역원 서열 (Immunogen Sequence)
RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIPUniProt 수납 번호
유전자 정보 (Gene Information)
Human GATAD2A (54815)
GATA zinc finger domain containing 2A (GATAD2A) comprises conserved regions complement receptor type 1 (CR1) and CR2.
The GATAD2A gene is mapped to human chromosome 19p13.11.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.