
Merck Anti-ELF3 antibody produced in rabbit
ELF3 단백질을 인식하는 토끼 유래 폴리클로날 항체로, 인체 시료에 반응합니다. Prestige Antibodies® 라인 제품이며, 면역조직화학(IHC)에 적합합니다. 친화력 정제된 항체로 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-ELF3 antibody produced in rabbit
Anti-ELF3 antibody produced in rabbit
제품 개요
Ab1, Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
향상된 검증
- independent
- orthogonal RNAseq
- recombinant expression
자세한 내용은 Antibody Enhanced Validation 참조
적용 기술
immunohistochemistry: 1:20–1:50
면역원 서열
QASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHP
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ELF3 (1999)
ELF3 (E74-like factor 3) gene is mapped to human chromosome 1q32.2. It is expressed in normal epithelia during keratinocyte differentiation. It is also found to be expressed in cell lines of epithelial origin and in organs with specialized epithelial cells such as lung, stomach, intestine, and kidney.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | rabbit |
| 품질 등급 | 100 |
| 결합 | unconjugated |
| 항체 형태 | affinity isolated antibody |
| 항체 유형 | primary antibodies |
| 클론 | polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | buffered aqueous glycerol solution |
| 반응 종 | human |
| 포장 | 25 μL |
| 적용 기술 | IHC (1:20–1:50) |
| 배송 상태 | wet ice |
| 저장 온도 | −20°C |
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



