AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-PLP1 antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-PLP1 항체로, 인간 PLP1 단백질을 표적하는 polyclonal primary antibody입니다. Prestige Antibodies® Powered by Atlas Antibodies 제품으로, 면역조직화학(IHC)에 적합하며 −20°C에서 보관됩니다. Buffered aqueous glycerol 용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-PLP1 antibody produced in rabbit
Anti-PLP1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈의 Anti-PLP1 항체로, rabbit에서 생산된 affinity isolated polyclonal antibody입니다. Buffered aqueous glycerol 용액 형태로 제공되며, 인간 PLP1 단백질에 반응합니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody Type | Primary antibody |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Small pack of 25 μL |
| Validation | Orthogonal RNAseq (Antibody Enhanced Validation) |
| Technique(s) | Immunohistochemistry: 1:500–1:1000 |
| Immunogen Sequence | LLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGI |
| UniProt Accession | P60201 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20°C |
Gene Information
Human PLP1 (5354) gene encodes two major CNS myelin proteins: proteolipid protein (PLP) and DM20.
This gene is located on human chromosome Xq22.2.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.