AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-PGRMC1 antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 polyclonal anti-PGRMC1 항체로, human, mouse, rat에 반응합니다. Prestige Antibodies® 라인 제품이며, buffered aqueous glycerol 용액 형태입니다. immunoblotting 및 immunohistochemistry에 적합하며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-PGRMC1 antibody produced in rabbit
Anti-PGRMC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
Rabbit polyclonal anti-PGRMC1 antibody reacts with human membrane-associated progesterone receptor component 1.
제품 스펙
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human, Mouse, Rat |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Recombinant expression, Orthogonal RNAseq |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL; Immunohistochemistry: 1:500–1:1000 |
| 면역원 서열 | DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR |
| UniProt 수납 번호 | O00264 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human PGRMC1(10857) |
향상된 검증 정보
Recombinant expression 및 orthogonal RNAseq 기반으로 검증되었습니다.
자세한 내용은 Antibody Enhanced Validation 페이지를 참고하십시오.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.