CacheBy
Merck Anti-ODF2 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-ODF2 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-ODF2 항체로, 인간 ODF2 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 라인 제품으로, 면역조직화학(IHC)에 적합하며, 정제된 glycerol 완충 용액 형태로 제공됩니다. −20°C에서 보관합니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
Merck HPA001874-100UL Anti-ODF2 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-ODF2 antibody produced in rabbit

Anti-ODF2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution


제품 개요

본 항체는 토끼에서 생산된 polyclonal 항체로, 인간 ODF2 단백질을 인식합니다. Prestige Antibodies® Powered by Atlas Antibodies 라인의 제품으로, 면역조직화학(Immunohistochemistry) 실험에 적합합니다.


제품 사양

항목 내용
Biological source Rabbit
Quality level 100
Conjugation Unconjugated
Antibody form Affinity isolated antibody
Antibody type Primary antibody
Clone Polyclonal
Product line Prestige Antibodies® Powered by Atlas Antibodies
Formulation Buffered aqueous glycerol solution
Species reactivity Human
Packaging 25 μL (small pack)
Enhanced validation Orthogonal RNAseq
Applications (techniques) Immunohistochemistry (IHC): 1:500–1:1000
Immunogen sequence HKRGMKGDTVNVRRSVRVKTKNPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKMNRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLRHNIERMKEEKDFTILQKKHLQQEKE
UniProt accession no. Q5BJF6
Shipping conditions Wet ice
Storage temperature −20°C
Gene information Human ODF2 (Gene ID: 4957)

Gene Information

The outer dense fiber of sperm tails 2 (ODF2) gene is located on human chromosome 9q34.11. This gene encodes two proteins: the testis-specific structural protein ODF2 and the ubiquitous centriolar protein cenexin.


참고 링크

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.