Merck Anti-TES antibody produced in rabbit

Anti-TES antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution

생물학적 정보

• Source: Rabbit
• Clonality: Polyclonal
• Product Type: Primary antibody
• Conjugation: Unconjugated
• Form: Buffered aqueous glycerol solution
• Species Reactivity: Human
• Product Line: Prestige Antibodies® Powered by Atlas Antibodies

포장 및 저장

• Packaging: 25 μL (small pack)
• Shipping Condition: Wet ice
• Storage Temperature: −20 °C

검증 및 응용

• Enhanced Validation: Independent, Orthogonal RNAseq
  자세한 내용은 Antibody Enhanced Validation 문서를 참고하세요.
• Recommended Techniques:
  • Immunoblotting: 0.04–0.4 μg/mL
  • Immunofluorescence: 0.25–2 μg/mL
  • Immunohistochemistry: 1:200–1:500

면역원 서열

YCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKK

UniProt 수납 번호

Q9UGI8

Gene Information

• Species: Human
• Gene Symbol: TES (26136)
• Description: Testin LIM domain protein (TES) possesses three zinc-binding domains and consists of 421 amino acids. The gene encoding it is located on human chromosome 7q31.2.

제품 스펙 요약