
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-FHIT antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-FHIT polyclonal antibody로, 인간 FHIT 단백질 검출에 적합합니다. Prestige Antibodies® 라인 제품이며, IHC 및 Western blot에 사용됩니다. −20°C 보관, buffered aqueous glycerol solution 형태로 제공됩니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA018840-100UL Anti-FHIT antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
840,700원VAT 포함 924,770원
Merck Sigma · Merck Anti-FHIT antibody produced in rabbit
Anti-FHIT antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 향상된 검증 | Independent, recombinant expression |
| 기술(응용) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:20–1:50 |
| 면역원 서열 | FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE |
| UniProt 수납 번호 | P49789 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
| 유전자 정보 | Human FHIT(2272) |
Gene Information
The gene FHIT (fragile histidine triad protein) is mapped to human chromosome 3p14.2.
It belongs to the histidine-triad superfamily of nucleoside monophosphate hydrolases and transferases.
The protein is localized in the cytoplasm and nucleus.
참고
Learn more about Antibody Enhanced Validation
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



