AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-FHIT antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-FHIT polyclonal antibody로, 인간 FHIT 단백질 검출에 적합합니다. Prestige Antibodies® 라인 제품이며, IHC 및 Western blot에 사용됩니다. −20°C 보관, buffered aqueous glycerol solution 형태로 제공됩니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA018840-100UL Anti-FHIT antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
840,700원VAT 포함 924,770원
Merck Sigma · Merck Anti-FHIT antibody produced in rabbit
Anti-FHIT antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 향상된 검증 | Independent, recombinant expression |
| 기술(응용) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:20–1:50 |
| 면역원 서열 | FRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE |
| UniProt 수납 번호 | P49789 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
| 유전자 정보 | Human FHIT(2272) |
Gene Information
The gene FHIT (fragile histidine triad protein) is mapped to human chromosome 3p14.2.
It belongs to the histidine-triad superfamily of nucleoside monophosphate hydrolases and transferases.
The protein is localized in the cytoplasm and nucleus.
참고
Learn more about Antibody Enhanced Validation
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.