AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-SLC1A2 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-SLC1A2 rabbit polyclonal antibody로, 인간 SLC1A2 단백질을 검출하는 고품질 1차 항체입니다. Immunohistochemistry에 적합하며, Prestige Antibodies® 라인으로 향상된 검증(orthogonal RNAseq)을 거쳤습니다. −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-SLC1A2 antibody produced in rabbit
Anti-SLC1A2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Orthogonal RNAseq |
| 적용 기술 | Immunohistochemistry (1:500–1:1000) |
| 면역원 서열 | SLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNV |
| UniProt 번호 | P43004 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
유전자 정보
Human SLC1A2 (6506)
Excitatory amino acid transporter 2 (EAAT2) is a membrane glutamate transporter.
This gene localizes to human chromosome 11p13–12.
This protein is localized to the endfoot membrane of astrocytes and accounts for more than 90% of glutamate uptake in the central nervous system (CNS).
It is a resident of the astrocyte plasma membrane.
추가 정보
Learn more about Antibody Enhanced Validation
제품 이미지
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.