
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-FAM174A antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-FAM174A 항체로, 인간 단백질에 반응하며 Western blot, IF, IHC에 적합합니다. Prestige Antibodies® 라인 제품으로 친화 정제된 1차 항체이며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-FAM174A antibody produced in rabbit
Anti-FAM174A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
FAM174A (Family with sequence similarity 174, member A)는 막단백질로, 본 항체는 인간 FAM174A 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Product type | Primary antibodies |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Enhanced validation | Recombinant expression |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:50–1:200 |
| Immunogen sequence | RRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR |
| UniProt accession no. | Q8TBP5 |
| Shipping conditions | Wet ice |
| Storage temperature | −20 °C |
| Gene information | Human FAM174A (345757) |
참고 정보
Learn more about Antibody Enhanced Validation
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



