
Merck Anti-SLC29A2 antibody produced in rabbit
토끼에서 생산된 Anti-SLC29A2 항체로 인간 SLC29A2 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며 affinity isolated 형태입니다. 면역블롯 및 면역조직화학에 적합하며 −20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC29A2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
품질 등급
100
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
향상된 검증
recombinant expression
Learn more about Antibody Enhanced Validation
적용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunohistochemistry: 1:50–1:200
면역원 서열
KFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
Human SLC29A2 (3177)
The gene solute carrier family 29 member-2 (SLC29A2) has been mapped to human chromosome 11q13.
RT-PCR analysis showed expression of SLC29A2 in skeletal muscle, liver, lung, brain, kidney, heart, pancreas, and placenta.
GFP tagging demonstrated localization of the protein on the basolateral membrane in renal epithelial cells.
The di-leucine motif in SLC29A2 is important for surface expression of the protein.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|




