
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-DLEC1 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-DLEC1 항체로, 인간 DLEC1 단백질을 특이적으로 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로 면역형광 및 면역조직화학에 적합하며, 정제된 glycerol 완충 용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-DLEC1 antibody produced in rabbit
Anti-DLEC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
이 항체는 토끼에서 생산된 polyclonal 항체로, 인간 DLEC1 단백질을 인식합니다. Prestige Antibodies® Powered by Atlas Antibodies 라인에 속하며, 면역형광 및 면역조직화학 분석에 적합합니다.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibody |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Small pack of 25 μL |
| Enhanced validation | Orthogonal RNAseq |
| Techniques | Immunofluorescence: 0.25–2 μg/mL; Immunohistochemistry: 1:200–1:500 |
| Immunogen sequence | PPVKSVSRWCIDSELLRKHHLISPEDYYTDTVPFHSAPKGISLPGCSKLTFSCEKRSVQKKELNKKLEDSCRKKLAEFEDELDHTVDSLTWNLTPKAKERTREPLKKASQPRN |
| UniProt accession no. | Q9Y238 |
| Shipping conditions | Wet ice |
| Storage temperature | −20 °C |
| Gene information | Human DLEC1 (9940) |
유전자 정보
DLEC1 (deleted in lung and esophageal cancer protein 1) 유전자는 인간 염색체 3p21.3에 위치하며, 세포질에 존재하는 단백질을 암호화합니다. DLEC1은 DLC1 (deleted in lung cancer protein 1)으로도 알려져 있습니다.
참고
자세한 항체 검증 정보는 Antibody Enhanced Validation 페이지에서 확인할 수 있습니다.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



