AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-FCAR antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-FCAR 폴리클로날 항체로, 인간 FCAR 단백질을 인식합니다. Prestige Antibodies® Powered by Atlas Antibodies 라인 제품이며, 면역형광, 면역조직화학, 웨스턴 블롯에 적합합니다. 친화 정제된 항체로 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-FCAR antibody produced in rabbit
Anti-FCAR antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | 25 μL small pack |
| 향상된 검증 | Recombinant expression |
| 면역원 서열 | NWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK |
| UniProt 수납 번호 | P24071 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
적용 기술
- Immunofluorescence: 0.25–2 μg/mL
- Immunohistochemistry: 1:500–1:1000
- Western blot: 0.04–0.4 μg/mL
Gene Information
Human FCAR (2204)
The gene FCAR (Fc fragment of IgA receptor) encodes a glycoprotein belonging to the immunoglobulin gene superfamily. It is mapped to human chromosome 19q13.4 and is selectively expressed on human phagocytic cells, including monocytes, macrophages, eosinophils, and neutrophils.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.