AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-AMZ2 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-AMZ2 항체로, 인간 단백질에 반응하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로, 면역형광, 면역조직화학, 면역블롯에 적합합니다. −20°C에서 보관하며, 향상된 검증을 거친 고품질 항체입니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-AMZ2 antibody produced in rabbit
Anti-AMZ2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibodies |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Validated applications | Recombinant expression (Enhanced Validation) |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:500–1:1000 |
| Immunogen sequence | AGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDFEQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIIS |
| UniProt accession no. | Q86W34 |
| Shipping conditions | Wet ice |
| Storage temperature | −20°C |
| Gene information | Human AMZ2 (archaemetzincin-2), Gene ID: 51321 |
Gene Description
The gene AMZ2 (archaemetzincin-2) is located on human chromosome 17q24. It is mainly expressed in the testis and heart. The protein contains an archetypal zinc-binding site and a methionine residue characteristic of metzincins.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.