
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-ZBTB2 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-ZBTB2 항체로, 인간 ZBTB2 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로, IHC 및 Western blot에 적합합니다. 향상된 검증을 거쳤으며, −20°C에서 보관합니다.
- 카탈로그번호
- HPA023136-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA023136-100UL Anti-ZBTB2 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-ZBTB2 antibody produced in rabbit
Anti-ZBTB2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab1
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody product type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| 포장 | Small pack of 25 μL |
| 향상된 검증 | Recombinant expression (Antibody Enhanced Validation) |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:1000–1:2500 |
| 면역원 서열 | IFSYLLHLMYTGKMAPQLIDPVRLEQGIKFLHAYPLIQEASLASQGAFSHPDQVFPLASSLYGIQIADHQLR |
| UniProt 수납 번호 | Q8N680 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human ZBTB2 (57621) |
Gene Information
The gene ZBTB2 (zinc finger and BTB domain containing 2) is mapped to human chromosome 6q25.
It belongs to the POK (POZ and Krüppel) family of proteins.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



