
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-SPINK2 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-SPINK2 항체로, 인간 SPINK2 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 라인 제품으로 면역조직화학(IHC)에 적합하며, 정제된 수용성 글리세롤 용액 형태로 제공됩니다. −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-SPINK2 antibody produced in rabbit
Anti-SPINK2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
Serine protease inhibitor Kazal-type 2 (SPINK2), also known as HUSI-II (human seminal plasma inhibitor II), is a member of the SPINK family encoded by a gene located on human chromosome 4. It is primarily expressed in the testis and seminal vesicle. The SPINK2 protein features a typical Kazal domain containing six cysteine residues forming three disulfide bridges.
제품 사양
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 단위 | 25 μL (small pack) |
| 향상된 검증 | Orthogonal RNAseq |
| 적용 기술 | Immunohistochemistry (IHC): 1:200–1:500 |
| 면역원 서열 | KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC |
| UniProt 번호 | P20155 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
| 관련 유전자 | Human SPINK2 (6691) |
추가 정보
Learn more about Antibody Enhanced Validation
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



