CacheBy
Merck Anti-SPINK2 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-SPINK2 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-SPINK2 항체로, 인간 SPINK2 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 라인 제품으로 면역조직화학(IHC)에 적합하며, 정제된 수용성 글리세롤 용액 형태로 제공됩니다. −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-SPINK2 antibody produced in rabbit

Anti-SPINK2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution


제품 개요

Serine protease inhibitor Kazal-type 2 (SPINK2), also known as HUSI-II (human seminal plasma inhibitor II), is a member of the SPINK family encoded by a gene located on human chromosome 4. It is primarily expressed in the testis and seminal vesicle. The SPINK2 protein features a typical Kazal domain containing six cysteine residues forming three disulfide bridges.


제품 사양

항목 내용
생물학적 소스 Rabbit
품질 등급 100
결합 형태 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibody
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
제형 Buffered aqueous glycerol solution
반응 종 Human
포장 단위 25 μL (small pack)
향상된 검증 Orthogonal RNAseq
적용 기술 Immunohistochemistry (IHC): 1:200–1:500
면역원 서열 KYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC
UniProt 번호 P20155
배송 상태 Wet ice
저장 온도 −20 °C
관련 유전자 Human SPINK2 (6691)

추가 정보

Learn more about Antibody Enhanced Validation

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.