AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-POLD2 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-POLD2 항체로, 인간·쥐·마우스에 반응합니다. Prestige Antibodies® 라인 제품으로 RNAi knockdown으로 검증되었습니다. 면역형광, 면역블롯, 면역조직화학에 적합하며 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-POLD2 antibody produced in rabbit
Anti-POLD2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human, Rat, Mouse |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | RNAi knockdown |
| 기술(technique) | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | PRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQC |
| UniProt 수납 번호 | P49005 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human POLD2(5425) |
Gene Information
The DNA polymerase δ 2 subunit (POLD2) gene, with 11 exons spanning 10 kb of genomic DNA, is mapped to human chromosome 7.
The gene encoding a 50 kDa protein is characterized by a G+C-rich 5′-flanking region and lacks a typical TATA box.
The encoded protein is one of the components of the human DNA Pol δ complex.
추가 정보
Learn more about Antibody Enhanced Validation
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.