CacheBy
Merck Anti-POLD2 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-POLD2 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-POLD2 항체로, 인간·쥐·마우스에 반응합니다. Prestige Antibodies® 라인 제품으로 RNAi knockdown으로 검증되었습니다. 면역형광, 면역블롯, 면역조직화학에 적합하며 −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-POLD2 antibody produced in rabbit

Anti-POLD2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution


제품 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
반응 종 Human, Rat, Mouse
포장 25 μL (small pack)
향상된 검증 RNAi knockdown
기술(technique) Immunoblotting: 0.04–0.4 μg/mL
Immunofluorescence: 0.25–2 μg/mL
Immunohistochemistry: 1:50–1:200
면역원 서열 PRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQC
UniProt 수납 번호 P49005
배송 상태 Wet ice
저장 온도 −20°C
Gene Information Human POLD2(5425)

Gene Information

The DNA polymerase δ 2 subunit (POLD2) gene, with 11 exons spanning 10 kb of genomic DNA, is mapped to human chromosome 7.
The gene encoding a 50 kDa protein is characterized by a G+C-rich 5′-flanking region and lacks a typical TATA box.
The encoded protein is one of the components of the human DNA Pol δ complex.


추가 정보

Learn more about Antibody Enhanced Validation

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.