
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-CCAR2 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-CCAR2 항체로, Affinity 정제된 프라이머리 항체입니다. 인간, 생쥐, 랫트에 반응하며 Western blot, IF, IHC에 사용 가능합니다. Prestige Antibodies® 라인 제품으로 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-CCAR2 antibody produced in rabbit
Anti-CCAR2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution (Ab1)
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Rat, Human, Mouse |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증(Enhanced Validation) | Independent, Orthogonal RNAseq |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:500–1:1000 |
| 면역원 서열 (Immunogen Sequence) | MLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALD |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
Gene Information
Gene: KIAA1967 (57805)
Species: Human
KIAA1967 is a large multi-domain containing nuclear protein mapped on chromosomal location 8p22. It consists of a NL (nuclear localization) motif, a CC (coiled-coil) domain responsible for the protein-protein interaction, an inactive EF-hand for Ca²⁺ binding, a Nudix domain, a RNA-binding domain, and an LZ (leucine zipper) motif.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



