AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-SLBP antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-SLBP rabbit polyclonal antibody로, 인간 SLBP 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, immunohistochemistry와 western blot에 적합합니다. −20°C에서 보관하며, affinity isolated 형식으로 높은 품질을 제공합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA019254-100UL Anti-SLBP antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-SLBP antibody produced in rabbit
Anti-SLBP antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 정보
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibody |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Small pack of 25 μL |
| Shipping condition | Wet ice |
| Storage temperature | −20°C |
향상된 검증 (Enhanced Validation)
- Independent validation
- Orthogonal RNAseq
자세한 내용은 Antibody Enhanced Validation 관련 기술 문서를 참고하세요.
적용 기술 (Applications)
- Immunohistochemistry: 1:500–1:1000
- Western blot: 0.04–0.4 μg/mL
면역원 서열 (Immunogen Sequence)
CDGDASFTTPEGPKPRSRCSDWASAVEEDEMRTRVNKEMARYKRKLLINDFGRERKSSSGSSDSKESMSTVPADFETDESVLMRRQKQINYGKNTI
UniProt 정보
- UniProt Accession: Q14493
유전자 정보 (Gene Information)
- Gene: SLBP (7884)
- Description: The gene SLBP (histone stem-loop-binding protein) is mapped to human chromosome 4p16.3. SLBP level increases when the cell enters S phase and is degraded at the end of S phase. The protein localizes mainly in the nucleus.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.