CacheBy
Merck Anti-SLC28A3 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-SLC28A3 antibody produced in rabbit

상품 한눈에 보기

Rabbit에서 생산된 Anti-SLC28A3 폴리클로날 항체로, 인간 SLC28A3 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 면역블롯 및 면역조직화학에 사용 가능하며, 향상된 검증을 거친 고품질 항체입니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
Merck HPA024729-100UL Anti-SLC28A3 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-SLC28A3 antibody produced in rabbit

Anti-SLC28A3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution, Ab2


제품 개요

이 항체는 rabbit에서 생산된 polyclonal primary antibody로, 인간 SLC28A3 단백질을 인식합니다. Prestige Antibodies® Powered by Atlas Antibodies 라인 제품이며, 향상된 검증을 통해 재조합 발현 기반으로 품질이 보증되었습니다.


제품 사양

항목 내용
생물학적 소스 Rabbit
품질 등급 100
결합 형태 Unconjugated
항체 형태 Affinity isolated antibody
항체 종류 Primary antibody
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species reactivity Human
포장 25 μL (small pack)
향상된 검증 Recombinant expression
Technique(s) Immunoblotting: 0.04–0.4 μg/mL
Immunohistochemistry: 1:200–1:500
면역원 서열 INCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNT
UniProt 번호 Q9HAS3
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Human SLC28A3 (solute carrier family 28 member 3) [Gene ID: 64078]
This gene is mapped to human chromosome 9q22 and is expressed in multiple tissues including pancreas, bone marrow, trachea, mammary gland, liver, prostate, intestine, brain, and heart. The protein contains 13 putative transmembrane helices.


제품 이미지

(이미지 없음)

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.