Merck Anti-GINS4 antibody produced in rabbit
Merck의 Anti-GINS4 rabbit polyclonal antibody는 인간 GINS4 단백질을 표적으로 하는 고품질 1차 항체입니다. Prestige Antibodies® 라인으로, recombinant expression 검증을 거쳤으며 immunoblotting, immunofluorescence, immunohistochemistry에 적합합니다. −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-GINS4 antibody produced in rabbit
Anti-GINS4 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab1
생물학적 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 종류 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| 향상된 검증 | Recombinant expression |
| UniProt 수납 번호 | Q9BRT9 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
적용 기술
| 실험 기술 | 사용 농도 |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:50–1:200 |
면역원 서열
MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEE
유전자 정보
Human GINS4 (84296)
The gene GINS4 (GINS complex subunit 4) is mapped to human chromosome 8p11.21.
GINS4 is a subunit of the GINS (go, ichi, nii, and san) complex, a heterotetrameric complex.
This complex is a crucial component of the replicative helicase machinery involved in replisome progression and establishment of DNA replication forks.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.