AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-EBAG9 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-EBAG9 항체는 토끼에서 생산된 polyclonal primary antibody로 인간 EBAG9 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, 면역조직화학(IHC)에 1:200~1:500 희석 비율로 사용됩니다. −20°C에서 보관하며, 독립 검증을 거친 고품질 항체입니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA021153-100UL Anti-EBAG9 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
840,700원VAT 포함 924,770원
Merck Sigma · Merck Anti-EBAG9 antibody produced in rabbit
Anti-EBAG9 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab1
제품 개요
- Biological Source: Rabbit
- Quality Level: 100
- Conjugate: Unconjugated
- Antibody Type: Primary antibodies
- Clone: Polyclonal
- Product Line: Prestige Antibodies® Powered by Atlas Antibodies
- Form: Buffered aqueous glycerol solution
- Species Reactivity: Human
- Packaging: 25 μL small pack
- Enhanced Validation: Independent (Learn more: Antibody Enhanced Validation)
- Technique(s): Immunohistochemistry (IHC) 1:200–1:500
- Immunogen Sequence: RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
- UniProt Accession Number: O00559
- Shipping Condition: Wet ice
- Storage Temperature: −20 °C
Gene Information
Human EBAG9 (9166)
The gene EBAG9 (estrogen receptor-binding fragment-associated gene 9) is mapped to human chromosome 8q23.
It is a type II transmembrane protein and is ubiquitously expressed.
EBAG9 localizes at the Golgi complex and also exists in soluble form.
It is commonly referred to as RCAS1 (receptor-binding cancer antigen expressed on SiSo cells).
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.