CacheBy
Merck Anti-HPGDS antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-HPGDS antibody produced in rabbit

상품 한눈에 보기

Merck의 토끼 유래 Anti-HPGDS 항체로, 인간 HPGDS 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로 면역조직화학에 적합하며, 정제된 glycerol 완충 용액 형태로 제공됩니다. −20°C에서 보관합니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Merck HPA024035-100UL Anti-HPGDS antibody produced in rabbit, 100uL pk판매 단위 pk
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-HPGDS antibody produced in rabbit

Anti-HPGDS antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution


제품 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
Antibody Product Type Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태(Form) Buffered aqueous glycerol solution
Species Reactivity Human
포장 Antibody small pack of 25 μL
향상된 검증 Orthogonal RNAseq (Antibody Enhanced Validation)
기술(Technique) Immunohistochemistry: 1:50–1:200
면역원 서열 KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Gene: human [PGDS (27306)]
The prostaglandin D2 synthase (PGDS) gene is mapped to the human chromosome 4q22.3. The encoded protein exists in two forms: the lipocalin-type PGDS (L-PGDS) and the hematopoietic PGDS (H-PGDS).
H-PGDS is found in Th2 cells, mast cells, and dendritic cells. It is a cytosolic enzyme and belongs to the sigma class of the glutathione S-transferase family of enzymes.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.