
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-HPGDS antibody produced in rabbit
상품 한눈에 보기
Merck의 토끼 유래 Anti-HPGDS 항체로, 인간 HPGDS 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로 면역조직화학에 적합하며, 정제된 glycerol 완충 용액 형태로 제공됩니다. −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA024035-100UL Anti-HPGDS antibody produced in rabbit, 100uL pk판매 단위 pk
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-HPGDS antibody produced in rabbit
Anti-HPGDS antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 향상된 검증 | Orthogonal RNAseq (Antibody Enhanced Validation) |
| 기술(Technique) | Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Gene: human [PGDS (27306)]
The prostaglandin D2 synthase (PGDS) gene is mapped to the human chromosome 4q22.3. The encoded protein exists in two forms: the lipocalin-type PGDS (L-PGDS) and the hematopoietic PGDS (H-PGDS).
H-PGDS is found in Th2 cells, mast cells, and dendritic cells. It is a cytosolic enzyme and belongs to the sigma class of the glutathione S-transferase family of enzymes.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



