AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-ZFAND2A antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-ZFAND2A 폴리클로날 항체로, 인간 ZFAND2A 단백질을 인식합니다. Prestige Antibodies® 시리즈로 향상된 검증을 거쳤으며, Western blot 및 IHC에 적합합니다. −20°C에서 보관하며, 25 μL 포장으로 제공됩니다.
- 카탈로그번호
- HPA019469-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA019469-100UL Anti-ZFAND2A antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-ZFAND2A antibody produced in rabbit
Anti-ZFAND2A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
제품 개요
- 토끼에서 생산된 폴리클로날 항체
- 인간 ZFAND2A 단백질을 인식
- Prestige Antibodies® Powered by Atlas Antibodies 라인 제품
- 향상된 검증(Enhanced Validation) 완료
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibody |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | 25 μL (small pack) |
| Enhanced validation | Recombinant expression |
| Techniques | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:20–1:50 |
| Immunogen sequence | KGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG |
| UniProt accession no. | Q8N6M9 |
| Shipping condition | Wet ice |
| Storage temperature | −20 °C |
| Gene information | Human ZFAND2A (90637) |
Gene Information
The gene ZFAND2A (AN1-type zinc finger protein 2A) is mapped to human chromosome 7p22.3.
In Caenorhabditis elegans, the protein localizes in the cytoplasm and nucleus.
ZFAND2A is also known as arsenite-inducible regulatory particle-associated protein (AIRAP).
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.