
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-ANGPT1 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-ANGPT1 항체로 인간 ANGPT1 단백질에 특이적입니다. Prestige Antibodies® 라인 제품으로 친화 정제된 1차 항체입니다. 면역조직화학(IHC) 실험에 적합하며 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-ANGPT1 antibody produced in rabbit
Anti-ANGPT1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab1
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | 25 μL (small pack) |
| 향상된 검증 | Orthogonal RNAseq |
| 적용 기술 | Immunohistochemistry (IHC): 1:20–1:50 |
| 면역원 서열 | EKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFR |
| UniProt 번호 | Q15389 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Gene: ANGPT1 (human, 284)
The angiopoietin-1 (ANGPT1) gene is located on human chromosome 8q23.1 and belongs to the angiopoietin family of growth factors. The protein contains coiled-coil domains at the amino terminus and a fibrinogen-like domain at the carboxyl terminus.
참고 링크
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



