AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-UPK3A antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-UPK3A rabbit polyclonal 항체로, 인체 UPK3A 단백질 검출에 적합. Prestige Antibodies® 라인으로 높은 특이성과 품질 보장. 면역조직화학(IHC) 1:200–1:500 희석 비율로 사용 가능. −20°C에서 안정적으로 보관.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-UPK3A antibody produced in rabbit
Anti-UPK3A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, Ab2
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| 품질 등급 | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| 반응 종 | Human |
| 포장 | 25 μL (small pack) |
| 검증 방법 | Independent, Orthogonal RNAseq |
| 실험 기술 | Immunohistochemistry (IHC): 1:200–1:500 |
| 면역원 서열 | QILNAYLVRVGANGTCLWDPNFQGLCNPPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGGMIVIT |
| UniProt 번호 | O75631 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human gene UPK3A (7380)
The gene uroplakin-3a (UPK3A) is mapped to human chromosome 22q. It is a transmembrane protein located at the apical membrane of superficial umbrella cells of the urothelium.
추가 정보
Learn more about Antibody Enhanced Validation
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.