
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-LPO antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-LPO 폴리클로날 항체로 인간 LPO 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며 면역조직화학에 적합합니다. 정제된 항체 형태로 −20°C에서 보관하며 orthogonal RNAseq으로 검증되었습니다.
- 카탈로그번호
- HPA028688-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA028688-100UL Anti-LPO antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-LPO antibody produced in rabbit
Anti-LPO antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
생물학적 정보
- Source: Rabbit
- Clonality: Polyclonal
- Conjugation: Unconjugated
- Species Reactivity: Human
- Immunogen Sequence:
IVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAR - UniProt Accession: P22079
제품 사양
| 항목 | 내용 |
|---|---|
| Antibody Type | Primary antibody |
| Antibody Form | Affinity isolated antibody |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Packaging | 25 μL (small pack) |
| Quality Level | 100 |
| Technique(s) | Immunohistochemistry (1:1000–1:2500) |
| Enhanced Validation | Orthogonal RNAseq |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20°C |
유전자 정보
Gene: LPO (4025)
Lactoperoxidase (LPO), also known as salivary peroxidase (SPO), is an oxidoreductase encoded by a gene mapped to human chromosome 17q22. LPO is secreted from the mammary and salivary glands and is present in mature human milk. The encoded protein belongs to the mammalian heme peroxidase superfamily.
제품 이미지
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



