
Merck Anti-GEM antibody produced in rabbit
Merck의 Anti-GEM antibody는 rabbit에서 생산된 polyclonal primary antibody로, 인간 GEM 단백질에 반응합니다. Prestige Antibodies® 라인 제품으로 immunoblotting과 immunohistochemistry에 적합하며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-GEM antibody produced in rabbit
Anti-GEM antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
생물학적 소스
rabbit
품질 등급
100
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장 단위
antibody small pack of 25 μL
향상된 검증
recombinant expression
자세한 내용은 Antibody Enhanced Validation 페이지를 참조하세요.
적용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunohistochemistry: 1:50–1:200
면역원 서열
NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human GEM(2669)
The gene GEM (GTP binding protein overexpressed in skeletal muscle) is mapped to human chromosome 8q22–24. It belongs to the Ras superfamily and RGK (Rad and Kir/Gem) family. The encoded protein has Ras-like core and extended N and C termini.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated |
| Antibody Type | Primary, Polyclonal |
| Product Line | Prestige Antibodies® |
| Formulation | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Package Size | 25 μL |
| Validation | Recombinant expression |
| Techniques | Immunoblotting, Immunohistochemistry |
| Immunogen Sequence | NTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITD |
| UniProt Accession | P55040 |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
| Gene Information | GEM (2669), Ras superfamily, chromosome 8q22–24 |
제품 이미지
(이미지 없음)
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



